Iright
BRAND / VENDOR: Proteintech

Proteintech, 24584-1-AP, SLCO4C1 Polyclonal antibody

CATALOG NUMBER: 24584-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SLCO4C1 (24584-1-AP) by Proteintech is a Polyclonal antibody targeting SLCO4C1 in WB, IHC, ELISA applications with reactivity to human, mouse samples 24584-1-AP targets SLCO4C1 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: human plasma, mouse kidney tissue Positive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information SLCO4C1 is the only OATP ( organic anion transporting polypeptide) expressed at the human kidney's basolateral side of proximal tubular cells and mediates the excretion of uremic toxins (PMID: 21656517). Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20177 Product name: Recombinant human SLCO4C1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-105 aa of BC152989 Sequence: MKSAKGIENLAFVPSSPDILRRLSASPSQIEVSALSSDPQRENSQPQELQKPQEPQKSPEPSLPSAPPNVSEEKLRSLSLSEFEEGSYGWRNFHPQCLQRCNTPG Predict reactive species Full Name: solute carrier organic anion transporter family, member 4C1 Calculated Molecular Weight: 724 aa, 79 kDa Observed Molecular Weight: 60-85 kDa GenBank Accession Number: BC152989 Gene Symbol: SLCO4C1 Gene ID (NCBI): 353189 RRID: AB_2879622 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6ZQN7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924