Proteintech, 24585-1-AP, TEX15 Polyclonal antibody

Size: 20ul / 150ul The TEX15 (24585-1-AP) by Proteintech is a Polyclonal antibody targeting TEX15 in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples 24585-1-AP targets TEX15 in WB, IP, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: rat testis tissue Positive IP detected in: PC-3 cells Positive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information TEX15 also named as Cancer/testis antigen 42 is a 2789 amino acid protein, which is expressed exclusively in testicular and cancerous tissues and may be involved in the development and metastasis of several different types of tumors. TEX15 exists as a 1279 amino acid protein in the mouse and rat testis. The molecular weight of mouse/rat TEX15 is 150 kDa (PMID: 26959739). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20170 Product name: Recombinant human TEX15 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-97 aa of BC141841 Sequence: MPSDAKDSVNGDLLLNWTSLKNILSGLNASFPLHNNTGSSTVTTSKSIKDPRLMRREESMGEQSSTAGLNEVLQFEKSSDNVNSEIKSTPSNSASSS Predict reactive species Full Name: testis expressed 15 Calculated Molecular Weight: 2789 aa, 315 kDa Observed Molecular Weight: 150 kDa GenBank Accession Number: BC141841 Gene Symbol: TEX15 Gene ID (NCBI): 56154 RRID: AB_2879623 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BXT5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.