Proteintech, 24604-1-AP, GALNT13 Polyclonal antibody

Size: 20ul / 150ul The GALNT13 (24604-1-AP) by Proteintech is a Polyclonal antibody targeting GALNT13 in WB, IHC, ELISA applications with reactivity to human samples 24604-1-AP targets GALNT13 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells Positive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Polypeptide N-acetylgalactosaminyltransferase 13 (GALNT13) is a recently identified member of the UDP-N-acetylgalactosamine: polypeptide N-acetyl galactosaminy transferases family, otherwise known as ppGalNAc-Tases, which control the initiation of mucin-type O-glycosylation. GALNT13 and the trimeric Tn antigen have been considered as tumor-associated antigens, and might be useful prognostic factors in many types of human cancers (PMID: 34830771, 27499036, 36575396) Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16526 Product name: Recombinant human GALNT13 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 499-561 aa of BC101032 Sequence: MRGNQLWEYDAESCLSVNKVADGSQHPTVETCNDSTLQKWLLRNYTRMEIFRNIFGNSTDYIL Predict reactive species Full Name: UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 13 (GalNAc-T13) Calculated Molecular Weight: 561 aa, 65 kDa Observed Molecular Weight: 64 kDa GenBank Accession Number: BC101032 Gene Symbol: GALNT13 Gene ID (NCBI): 114805 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8IUC8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.