Product Description
Size: 20ul / 150ul
The GPR58/TAAR2 (24609-1-AP) by Proteintech is a Polyclonal antibody targeting GPR58/TAAR2 in WB, ELISA applications with reactivity to human, mouse, rat samples
24609-1-AP targets GPR58/TAAR2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive WB detected in: rat brain tissue, mouse brain tissue, mouse cerebellum tissue
Recommended dilution
Western Blot (WB): WB : 1:500-1:1000
Specification
Tested Reactivity: human, mouse, rat
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag18939 Product name: Recombinant human TAAR2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 111-203 aa of BC067461 Sequence: TIPVIKRLLLLCWSVPGAFAFGVVFSEAYADGIEGYDILVACSSSCPVMFNKLWGTTLFMAGFFTPGSMMVGIYGKIFAVSRKHAHAINNLRE Predict reactive species
Full Name: trace amine associated receptor 2
Calculated Molecular Weight: 351 aa, 40 kDa
Observed Molecular Weight: 42 kDa
GenBank Accession Number: BC067461
Gene Symbol: TAAR2
Gene ID (NCBI): 9287
RRID: AB_2879636
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q9P1P5
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924