Proteintech, 24611-1-AP, LY6G5B Polyclonal antibody

Size: 20ul / 150ul The LY6G5B (24611-1-AP) by Proteintech is a Polyclonal antibody targeting LY6G5B in IHC, ELISA applications with reactivity to human samples 24611-1-AP targets LY6G5B in IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human tonsillitis tissue, human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:20-1:200 Specification Tested Reactivity: human Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18815 Product name: Recombinant human LY6G5B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 56-201 aa of BC146529 Sequence: MVITIYYDVKVRFIVRGCGQYISYRCQEKRNTYFAEYWYQAQCCQYDYCNSWSSPQLQSSLPEPHDRPLALPLSDSQIQWFYQALNLSLPLPNFHAGTEPDGLDPMVTLSLNLGLSFAELRRMYLFLNSSGLLVLPQAGLLTPHPS Predict reactive species Full Name: lymphocyte antigen 6 complex, locus G5B Calculated Molecular Weight: 201 aa, 23 kDa GenBank Accession Number: BC146529 Gene Symbol: LY6G5B Gene ID (NCBI): 58496 RRID: AB_2879638 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8NDX9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.