Proteintech, 24622-1-AP, DcR1/TNFRSF10C Polyclonal antibody

Size: 20ul / 150ul The DcR1/TNFRSF10C (24622-1-AP) by Proteintech is a Polyclonal antibody targeting DcR1/TNFRSF10C in WB, ELISA applications with reactivity to human samples 24622-1-AP targets DcR1/TNFRSF10C in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human peripheral blood leukocyte Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information Decoy receptor 1 (DcR1), also known as TNFRSF10C, CD263, TRAIL-R3, or TRID, is a member of the TNF-receptor superfamily. DcR1 is a receptor for the cytotoxic ligand TRAIL. In contrast to DR4/TRAIL-R1 and DR5/TRAIL-R2, DcR1 is a glycosylphosphatidylinositol (GPI)-linked membrane molecule that lacks a cytoplasmic region, including the death domain (PMID: 9314565; 9242611). DcR1 is not capable of inducing apoptosis and is thought to function as an antagonistic receptor that protects cells from TRAIL-induced apoptosis (PMID: 9242610). The apparent molecular weight of DcR1 is larger than the calculated molecular weight of 27 kDa, suggesting the presence of extensive post-translational modifications and/or unusual structural motifs (PMID: 9373179). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18399 Product name: Recombinant human TNFRSF10C protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 125-259 aa of BC125041 Sequence: CRKCSRCPSGEVQVSNCTSWDDIQCVEEFGANATVETPAAEETMNTSPGTPAPAAEETMNTSPGTPAPAAEETMTTSPGTPAPAAEETMTTSPGTPAPAAEETMTTSPGTPASSHYLSCTIVGIIVLIVLLIVFV Predict reactive species Full Name: tumor necrosis factor receptor superfamily, member 10c, decoy without an intracellular domain Calculated Molecular Weight: 259 aa, 27 kDa Observed Molecular Weight: 60 kDa GenBank Accession Number: BC125041 Gene Symbol: DcR1 Gene ID (NCBI): 8794 RRID: AB_3085741 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O14798 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.