Proteintech, 24626-1-AP, CEACAM7 Polyclonal antibody

Size: 20ul / 150ul The CEACAM7 (24626-1-AP) by Proteintech is a Polyclonal antibody targeting CEACAM7 in WB, IHC, ELISA applications with reactivity to human, mouse samples 24626-1-AP targets CEACAM7 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse colon tissue Positive IHC detected in: human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information CEACAM7, also known as CGM2, belongs to the carcinoembryonic antigen (CEA) family. CEACAM7 contains three domains: an N-terminal IgV domain, a single IgC2 domain, and a cell-surface GPI anchor domain. CEACAM7 achieves cell adhesion through dimerization of the N-terminal IgV domain. CEACAM7 is expressed on highly differentiated epithelial cells of the colon and rectum and on the epithelial cells within the ducts of the pancreas (PMID: 26323304). CEACAM7 has 2 isoforms with the molecular mass of 19 and 29 kDa. The observed MW of CEACAM7 is 58 kDa, which is consistent with the description in the literature (PMID: 36828119). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18579 Product name: Recombinant human CEACAM7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 113-213 aa of BC121132 Sequence: VTHNDAGIYTLHVIKENLVNEEVTRQFYVFSEPPKPSITSNNFNPVENKDIVVLTCQPETQNTTYLWWVNNQSLLVSPRLLLSTDNRTLVLLSATKNDIGP Predict reactive species Full Name: carcinoembryonic antigen-related cell adhesion molecule 7 Calculated Molecular Weight: 265 aa, 29 kDa Observed Molecular Weight: 58 kDa GenBank Accession Number: BC121132 Gene Symbol: CEACAM7 Gene ID (NCBI): 1087 RRID: AB_3085742 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q14002 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.