Proteintech, 24631-1-AP, B3GAT2 Polyclonal antibody

Size: 20ul / 150ul The B3GAT2 (24631-1-AP) by Proteintech is a Polyclonal antibody targeting B3GAT2 in WB, ELISA applications with reactivity to mouse, rat samples 24631-1-AP targets B3GAT2 in WB, ELISA applications and shows reactivity with mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, mouse cerebellum tissue, mouse kidney tissue, mouse retina tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Specification Tested Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18402 Product name: Recombinant human B3GAT2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 175-251 aa of BC113995 Sequence: FAVSLQVILSNPKAVFKRRGSQPGMQESDFLKQITTVEELEPKANNCTKVLVWHTRTEKVNLANEPKYHLDTVKIEV Predict reactive species Full Name: beta-1,3-glucuronyltransferase 2 (glucuronosyltransferase S) Calculated Molecular Weight: 323 aa, 37 kDa Observed Molecular Weight: 37 kDa GenBank Accession Number: BC113995 Gene Symbol: B3GAT2 Gene ID (NCBI): 135152 RRID: AB_3085743 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NPZ5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.