Iright
BRAND / VENDOR: Proteintech

Proteintech, 24639-1-AP, ISG20L2 Polyclonal antibody

CATALOG NUMBER: 24639-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ISG20L2 (24639-1-AP) by Proteintech is a Polyclonal antibody targeting ISG20L2 in WB, IF/ICC, IP, ELISA applications with reactivity to human samples 24639-1-AP targets ISG20L2 in WB, IF/ICC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells Positive IP detected in: HEK-293 cells Positive IF/ICC detected in: U2OS cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000 Background Information ISG20L2, also named HSD38, is a member of a vertebrate exonucleases family. ISG20L2 is composed of at least two functional domains, one at its N-terminal half allowing intracellular localization and association with the binding partners and the other at its C-terminal half bearing the 3` to 5` exoribonuclease activity. The molecular weight of ISG20L2 is 39 kDa (PMID: 18065403). Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20026 Product name: Recombinant human ISG20L2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-353 aa of BC000575 Sequence: MSTLLLNLDFGEPPPKKALEGNAKHRNFVKKRRLLERRGFLSKKNQPPSKAPKLHSEPSKKGETPTVDGTWKTPSFPKKKTAASSNGSGQPLDKKAAVSWLTPAPSKKADSVAAKVDLLGEFQSALPKINSHPTRSQKKSSQKKSSKKNHPQKNAPQNSTQAHSENKCSGASQKLPRKMVAIDCEMVGTGPKGHVSSLARCSIVNYNGDVLYDEYILPPCHIVDYRTRWSGIRKQHMVNATPFKIARGQILKILTGKIVVGHAIHNDFKALQYFHPKSLTRDTSHIPPLNRKADCPENATMSLKHLTKKLLNRDIQVGKSGHSSVEDAQATMELYKLVEVEWEEHLARNPPTD Predict reactive species Full Name: interferon stimulated exonuclease gene 20kDa-like 2 Calculated Molecular Weight: 353 aa, 39 kDa Observed Molecular Weight: 39 kDa GenBank Accession Number: BC000575 Gene Symbol: ISG20L2 Gene ID (NCBI): 81875 RRID: AB_2879649 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H9L3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924