Proteintech, 24646-1-AP, MTRFR Polyclonal antibody

Size: 20ul / 150ul The C12orf65 (24646-1-AP) by Proteintech is a Polyclonal antibody targeting C12orf65 in IHC, ELISA applications with reactivity to human samples 24646-1-AP targets C12orf65 in IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information C12orf65 participates in the process of mitochondrial translation and has been shown to be associated with a spectrum of phenotypes, including early onset optic atrophy, progressive encephalomyopathy, peripheral neuropathy, and spastic paraparesis. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19965 Product name: Recombinant human C12orf65 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 11-94 aa of BC062329 Sequence: TPLTRICPAPWGLRLWEKLTLLSPGIAVTPVQMAGKKDYPALLSLDENELEEQFVKGHGPGGQATNKTSNCVVLKHIPSGIVVK Predict reactive species Full Name: chromosome 12 open reading frame 65 Calculated Molecular Weight: 166 aa, 19 kDa GenBank Accession Number: BC062329 Gene Symbol: C12orf65 Gene ID (NCBI): 91574 RRID: AB_2879653 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H3J6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.