Iright
BRAND / VENDOR: Proteintech

Proteintech, 24664-1-AP, RBPJL Polyclonal antibody

CATALOG NUMBER: 24664-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The RBPJL (24664-1-AP) by Proteintech is a Polyclonal antibody targeting RBPJL in WB, ELISA applications with reactivity to human samples 24664-1-AP targets RBPJL in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells, Raji cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20284 Product name: Recombinant human RBPJL protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 428-517 aa of BC156875 Sequence: SPRSLVCVVPDVAAFCSDWRWLRAPITIPMSLVRADGLFYPSAFSFTYTPEYSVRPGHPGVPEPATDADALLESIHQEFTRTNFHLFIQT Predict reactive species Full Name: recombination signal binding protein for immunoglobulin kappa J region-like Calculated Molecular Weight: 517 aa, 57 kDa Observed Molecular Weight: 57-69 kDa GenBank Accession Number: BC156875 Gene Symbol: RBPJL Gene ID (NCBI): 11317 RRID: AB_2879663 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UBG7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924