Iright
BRAND / VENDOR: Proteintech

Proteintech, 24665-1-AP, ZBTB48 Polyclonal antibody

CATALOG NUMBER: 24665-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ZBTB48 (24665-1-AP) by Proteintech is a Polyclonal antibody targeting ZBTB48 in WB, ELISA applications with reactivity to human samples 24665-1-AP targets ZBTB48 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, K-562 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information ZBTB48, also named as TZAP and HKR3, is a 688 amino acid protein, which contains 1 BTB (POZ) domain and 11 C2H2-type zinc fingers and belongs to the krueppel C2H2-type zinc-finger protein family. ZBTB48 is detected in adrenal gland and neuroblastoma. ZBTB48 binds to and regulates the J and/or S elements in MHC II promoter. Zinc finger and BTB domain containing 48 (ZBTB48), also known as telomeric zinc-finger associated protein (TZAP), is a protein that triggers the trimming of telomeres in the absence of shelterin. ZBTB48, is a relatively uncharacterized POK family protein with a POZ-domain and 11 zinc finger domains. ZBTB48, is ubiquitously expressed in human tissues. The ZBTB48 gene is mapped to human chromosome 1p36, which is commonly rearranged (leiomyoma and leukemias) or deleted in various cancers (neuroblastoma, melanoma, Merkel cell carcinomas, pheochromocytoma and breast and colon carcinomas. A correlation between deletions or rearrangements of HKR3 and human cancer suggest a role for ZBTB48 as a potential tumor suppressor. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20301 Product name: Recombinant human ZBTB48 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-293 aa of BC013573 Sequence: MDGSFVQHSVRVLQELNKQREKGQYCDATLDVGGLVFKAHWSVLACCSHFFQSLYGDGSGGSVVLPAGFAEIFGLLLDFFYTGHLALTSGNRDQVLLAARELRVPEAVELCQSFKPKTSVGQAAGGQSGLGPPASQNVNSHVKEPAGLEEEEVSRTLGLVPRDQEPRGSHSPQRPQLHSPAQSEGPSSLCGKLKQALKPCPLEDKKPEDCKVPPRPLEAEGAQLQGGSNEWEVVVQVEDDGDGDYMSEPEAVLTRRKSNVIRKPCAAEPALSAGSLAAEPAENRKGTAVPVEC Predict reactive species Full Name: zinc finger and BTB domain containing 48 Calculated Molecular Weight: 688 aa, 77 kDa Observed Molecular Weight: 77 kDa GenBank Accession Number: BC013573 Gene Symbol: ZBTB48 Gene ID (NCBI): 3104 RRID: AB_2879664 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P10074 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924