Iright
BRAND / VENDOR: Proteintech

Proteintech, 24678-1-AP, C20orf46 Polyclonal antibody

CATALOG NUMBER: 24678-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The C20orf46 (24678-1-AP) by Proteintech is a Polyclonal antibody targeting C20orf46 in IHC, ELISA applications with reactivity to human, mouse samples 24678-1-AP targets C20orf46 in IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: human colon cancer tissue, human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information C20orf46, also named as TMEM74B, belongs to the TMEM74 family. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20385 Product name: Recombinant human C20orf46 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-122 aa of BC156781 Sequence: MPPAQGYEFAAAKGPRDELGPSFPMASPPGLELKTLSNGPQAPRRSAPLGPVAPTREGVENACFSSEEHETHFQNPGNTRLGSSPSPPGGVSSLPRSQRDDLSLHSEEGPALEPVSRPVDYG Predict reactive species Full Name: chromosome 20 open reading frame 46 Calculated Molecular Weight: 256 aa, 28 kDa GenBank Accession Number: BC156781 Gene Symbol: C20orf46 Gene ID (NCBI): 55321 RRID: AB_2879669 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NUR3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924