Product Description
Size: 20ul / 150ul
The PRY (24688-1-AP) by Proteintech is a Polyclonal antibody targeting PRY in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples
24688-1-AP targets PRY in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: human testis tissue
Positive IHC detected in: human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Positive IF/ICC detected in: PC-3 cells
Recommended dilution
Western Blot (WB): WB : 1:500-1:1000
Immunohistochemistry (IHC): IHC : 1:50-1:500
Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800
Background Information
PRY is Testis-specific PTP-BL-related Y protein which has two isoforms with MW 16 and 6-8 kDa.
Specification
Tested Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag20232 Product name: Recombinant human PRY2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-63 aa of BC153128 Sequence: MGATGLGFLLSWRQDNLNGTDCQGCNILYFSETTGSMCSELSLNRGLEARRKKDLKDSFLWRY Predict reactive species
Full Name: PTPN13-like, Y-linked 2
Calculated Molecular Weight: 147 aa, 17 kDa
Observed Molecular Weight: 7 kDa
GenBank Accession Number: BC153128
Gene Symbol: PRY
Gene ID (NCBI): 442862
RRID: AB_2879672
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: O14603
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924