Iright
BRAND / VENDOR: Proteintech

Proteintech, 24691-1-AP, EYA4 Polyclonal antibody

CATALOG NUMBER: 24691-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The EYA4 (24691-1-AP) by Proteintech is a Polyclonal antibody targeting EYA4 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 24691-1-AP targets EYA4 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, mouse heart tissue, mouse liver tissue, mouse skeletal muscle tissue, L02 cells, rat liver tissue Positive IHC detected in: human skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:100-1:400 Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200 Background Information EYA4 (Eyes absent homolog 4) participates directly in the modulation of cellular signaling through its phosphatase activity and plays a role in the embryonic and post-natal development of the mature organs of CORTI. This protein may be involved in the development of the eye. It has 5 isoforms produced by alternative splicing. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20466 Product name: Recombinant human EYA4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 130-201 aa of BC041063 Sequence: STPAAQTMSAYAGQTQYSGMQQPAVYTAYSQTGQPYSLPTYDLGVMLPAIKTESGLSQTQSPLQSGCLSYSP Predict reactive species Full Name: eyes absent homolog 4 (Drosophila) Calculated Molecular Weight: 639 aa, 70 kDa Observed Molecular Weight: 67-70 kDa GenBank Accession Number: BC041063 Gene Symbol: EYA4 Gene ID (NCBI): 2070 RRID: AB_2879675 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O95677 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924