Proteintech, 24698-1-AP, C5orf26 Polyclonal antibody

Size: 20ul / 150ul The C5orf26 (24698-1-AP) by Proteintech is a Polyclonal antibody targeting C5orf26 in IHC, IF/ICC, ELISA applications with reactivity to human samples 24698-1-AP targets C5orf26 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human liver cancer tissue, human brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells, HeLa cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20367 Product name: Recombinant human C5orf26 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-120 aa of BC112077 Sequence: MVQPAPPSRSRTVGPSTCRKALWDGSLSFLPFGASLLWFLLWVLWDGAWLWPRGLSRRGAGRGNAATLSLVSRLRRPVSEVSGAVNKGSGLASGLRSHVWKRGASSICVYIIDYAREFSR Predict reactive species Full Name: chromosome 5 open reading frame 26 Calculated Molecular Weight: 120 aa, 13 kDa GenBank Accession Number: BC112077 Gene Symbol: C5orf26 Gene ID (NCBI): 114915 RRID: AB_2879679 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.