Proteintech, 24699-1-AP, LPLUNC1 Polyclonal antibody

Size: 20ul / 150ul The LPLUNC1 (24699-1-AP) by Proteintech is a Polyclonal antibody targeting LPLUNC1 in WB, ELISA applications with reactivity to human samples 24699-1-AP targets LPLUNC1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human saliva Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information LPLUNC1 (Long Palate, Lung and Nasal Epithelium Carcinoma-Associated Protein 1) is a member of the PLUNC protein family and is a secretory protein primarily expressed in the mucosal epithelium of the respiratory tract. As a key component of innate immunity, LPLUNC1 exhibits antimicrobial activity by directly binding to lipopolysaccharides and inhibiting bacterial growth. Recent studies have revealed that LPLUNC1 expression is significantly downregulated in various tumors, including nasopharyngeal carcinoma and lung cancer. It exerts tumor-suppressive effects by regulating signaling pathways such as NF-κB and STAT3, thereby inhibiting tumor cell proliferation and promoting apoptosis. Its expression level is closely associated with tumor stage and prognosis, making it a potential diagnostic biomarker and therapeutic target for cancer. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20056 Product name: Recombinant human C20orf114 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 225-325 aa of BC008429 Sequence: LSIDRLEFDLLYPAIKGDTIQLYLGAKLLDSQGKVTKWFNNSAASLTMPTLDNIPFSLIVSQDVVKAAVAAVLSPEEFMVLLDSVLPESAHRLKSSIGLIN Predict reactive species Full Name: chromosome 20 open reading frame 114 Calculated Molecular Weight: 484 aa, 52 kDa Observed Molecular Weight: 50 kDa GenBank Accession Number: BC008429 Gene Symbol: C20orf114 Gene ID (NCBI): 92747 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8TDL5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.