Iright
BRAND / VENDOR: Proteintech

Proteintech, 24725-1-AP, FGFBP3 Polyclonal antibody

CATALOG NUMBER: 24725-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The FGFBP3 (24725-1-AP) by Proteintech is a Polyclonal antibody targeting FGFBP3 in WB, IF/ICC, ELISA applications with reactivity to human, mouse samples 24725-1-AP targets FGFBP3 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293 cells Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100 Background Information FGFBP3 also named as C10orf13 or FGF binding protein 3 is 258 amino acid protein, which belongs to the fibroblast growth factor binding family. FGFBP3 is a secreted protein and may play a role in the regulation of gene transcription. The molecular weight of FGFBP3 is 29kDa, but our results detected the 60-65kDa protein by western blot. We infer that FGFBP3 may exist as dimer. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20573 Product name: Recombinant human FGFBP3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-258 aa of BC025966 Sequence: MTPPKLRASLSPSLLLLLSGCLLAAARREKGAASNVAEPVPGPTGGSSGRFLSPEQHACSWQLLLPAPEAAAGSELALRCQSPDGARHQCAYRGHPERCAAYAARRAHFWKQVLGGLRKKRRPCHDPAPLQARLCAGKKGHGAELRLVPRASPPARPTVAGFAGESKPRARNRGRTRERASGPAAGTPPPQSAPPKENPSERKTNEGKRKAALVPNEERPMGTGPDPDGLDGNAELTETYCAEKWHSLCNFFVNFWNG Predict reactive species Full Name: fibroblast growth factor binding protein 3 Calculated Molecular Weight: 258 aa, 28 kDa Observed Molecular Weight: 60-65 kda GenBank Accession Number: BC025966 Gene Symbol: FGFBP3 Gene ID (NCBI): 143282 RRID: AB_2879691 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8TAT2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924