Iright
BRAND / VENDOR: Proteintech

Proteintech, 24727-1-AP, TRPC1 Polyclonal antibody

CATALOG NUMBER: 24727-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TRPC1 (24727-1-AP) by Proteintech is a Polyclonal antibody targeting TRPC1 in WB, IHC, ELISA applications with reactivity to human, mouse , rat samples 24727-1-AP targets TRPC1 in WB, IHC, ELISA applications and shows reactivity with human, mouse , rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Positive IHC detected in: rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information TRPC1, also named as TRP1, belongs to the transient receptor family and STrpC subfamily. TRPC1 is thought to form a receptor-activated non-selective calcium permeant cation channel. It has been reported that the mGluR1 evoked slow EPSC is mediated by the TRPC1 cation channel. It is operated by a phosphatidylinositol second messenger system activated by receptor tyrosine kinases or G-protein coupled receptors. Specification Tested Reactivity: human, mouse , rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16488 Product name: Recombinant human TRPC1 protein Source: e coli. -derived, T-HIS Tag: 6*His Domain: 1-349 aa of BC113953 Sequence: MMAALYPSTDLSGASSSSLPSSPSSSSPNEVMALKDVREVKEENTLNEKLFLLACDKGDYYMVKKILEENSSGDLNINCVDVLGRNAVTITIENENLDILQLLLDYGCQKLMERIQNPEYSTTMDVAPVILAAHRNNYEILTMLLKQDVSLPKPHAVGCECTLCSAKNKKDSLRHSRFRLDIYRCLASPALIMLTEEDPILRAFELSADLKELSLVEVEFRNDYEELARQCKMFAKDLLAQARNSRELEVILNHTSSDEPLDKRGLLEERMNLSRLKLAIKYNQKEFVSQSNCQQFLNTVWFGQMSGYRRKPTCKKIMTVLTVGIFWPVLSLCYLIAPKSQFGRIIHTP Predict reactive species Full Name: transient receptor potential cation channel, subfamily C, member 1 Calculated Molecular Weight: 793 aa, 91 kDa Observed Molecular Weight: 120 kDa GenBank Accession Number: BC113953 Gene Symbol: TRPC1 Gene ID (NCBI): 7220 RRID: AB_3085750 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P48995 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924