Iright
BRAND / VENDOR: Proteintech

Proteintech, 24743-1-AP, ACE Polyclonal antibody

CATALOG NUMBER: 24743-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ACE (24743-1-AP) by Proteintech is a Polyclonal antibody targeting ACE in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 24743-1-AP targets ACE in WB, IHC, IF, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse heart tissue Positive IHC detected in: rat lung tissue, human lung tissue, mouse lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information ACE(Angiotensin-converting enzyme) is also named as DCP, DCP1 and belongs to the peptidase M2 family. It is involved in catalyzing the conversion of angiotensin I into a physiologically active peptide angiotensin II. ACE also has a glycosidase activity which releases GPI-anchored proteins from the membrane by cleaving the mannose linkage in the GPI moiety. It has 4 isoforms produced by alternative splicing. The full length protein has 15 glycosylation sites and it can show a molecular weight of 170 kDa(PMID:16804085). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, bovine Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20654 Product name: Recombinant human ACE protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 390-739 aa of BC036375 Sequence: FYNGKDFRIKQCTTVNLEDLVVAHHEMGHIQYFMQYKDLPVALREGANPGFHEAIGDVLALSVSTPKHLHSLNLLSSEGGSDEHDINFLMKMALDKIAFIPFSYLVDQWRWRVFDGSITKENYNQEWWSLRLKYQGLCPPVPRTQGDFDPGAKFHIPSSVPYIRYFVSFIIQFQFHEALCQAAGHTGPLHKCDIYQSKEAGQRLATAMKLGFSRPWPEAMQLITGQPNMSASAMLSYFKPLLDWLRTENELHGEKLGWPQYNWTPNSDDFYNETETKIFLQFYDQTGIWDHGAPHLLPPSQARGTREAPVYMSKRAASSGPPGSPKLPPAAQGHGEVPVHDLLWHPGPPV Predict reactive species Full Name: angiotensin I converting enzyme (peptidyl-dipeptidase A) 1 Calculated Molecular Weight: 150 kDa Observed Molecular Weight: 170 kDa GenBank Accession Number: BC036375 Gene Symbol: ACE Gene ID (NCBI): 1636 RRID: AB_2879701 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P12821 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924