Product Description
Size: 20ul / 150ul
The INSIG2 (24766-1-AP) by Proteintech is a Polyclonal antibody targeting INSIG2 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples
24766-1-AP targets INSIG2 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive WB detected in: rat liver tissue, A549 cells, SGC-7901 cells
Positive IP detected in: mouse liver tissue
Positive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Positive IF/ICC detected in: HepG2 cells
Recommended dilution
Western Blot (WB): WB : 1:500-1:2000
Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC): IHC : 1:20-1:200
Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
Background Information
INSIG2 mediates feedback control of cholesterol synthesis by controlling SCAP and HMGCR. INSIG2 may bring HMGCR into ubiquitin-mediated proteasomal degradation. Insig2 protein are endoplasmic reticulum proteins that block the processing of sterol regulatory element binding proteins (SREBPs) by binding to SREBP cleavage-activating protein (SCAP), and thus prevent SCAP from escorting SREBPs to the Golgi. INSIG-2 may play an important role in therapy of hypercholesterolemia.
Specification
Tested Reactivity: human, mouse, rat
Cited Reactivity: human, mouse, rat, monkey
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag14072 Product name: Recombinant human INSIG2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 79-139 aa of BC022475 Sequence: TASAVIGLLYPCIDRHLGEPHKFKREWSSVMRCVAVFVGINHASAKVDFDNNIQLSLTLAA Predict reactive species
Full Name: INSIG 2
Calculated Molecular Weight: 225 aa, 25 kDa
Observed Molecular Weight: 30 kDa
GenBank Accession Number: BC022475
Gene Symbol: INSIG2
Gene ID (NCBI): 51141
RRID: AB_2811285
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q9Y5U4
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924