Iright
BRAND / VENDOR: Proteintech

Proteintech, 24780-1-AP, IKZF5 Polyclonal antibody

CATALOG NUMBER: 24780-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The IKZF5 (24780-1-AP) by Proteintech is a Polyclonal antibody targeting IKZF5 in WB, IP, ELISA applications with reactivity to human samples 24780-1-AP targets IKZF5 in WB, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells, HeLa cells, HL-60 cells Positive IP detected in: Jurkat cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20405 Product name: Recombinant human IKZF5 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 140-376 aa of BC022564 Sequence: CELCSFRCSDRSNLSHHRRRKHKMVPIKGTRSSLSSKKMWGVLQKKTSNLGYSRRALINLSPPSVVVQKPDYLNDFTHEIPNIQTDSYESMAKTTPTGGLPRDPQELMVDNPLNQLSTLAGQLSSLPPENQNPASPDVVPCPDEKPFMIQQPSTQAVVSAVSASIPQSSSPTSPEPRPSHSQRNYSPVAGPSSEPSAHTSTPSIGNSQPSTPAPALPVQDPQLLHHCQHCDMYFADN Predict reactive species Full Name: IKAROS family zinc finger 5 (Pegasus) Calculated Molecular Weight: 420 aa, 47 kDa Observed Molecular Weight: 47 kDa GenBank Accession Number: BC022564 Gene Symbol: IKZF5 Gene ID (NCBI): 64376 RRID: AB_2879717 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H5V7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924