Proteintech, 24800-1-AP, PRLHR Polyclonal antibody

Size: 20ul / 150ul The PRLHR (24800-1-AP) by Proteintech is a Polyclonal antibody targeting PRLHR in WB, ELISA applications with reactivity to human, rat samples 24800-1-AP targets PRLHR in WB, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: HepG2 cells, Jurkat cells, SH-SY5Y cells, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information PRLHR (prolactin-releasing hormone receptor) is implicated in lactation, regulation of food intake, and pain-signal processing. Specification Tested Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20098 Product name: Recombinant human PRLHR protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-73 aa of BC101490 Sequence: MASSTTRGPRVSDLFSGLPPAVTTPANQSAEASAGNGSVAGADAPAVTPFQSLQLVHQLKGLIVLLYSVVVVV Predict reactive species Full Name: prolactin releasing hormone receptor Calculated Molecular Weight: 370 aa, 41 kDa Observed Molecular Weight: 41 kDa GenBank Accession Number: BC101490 Gene Symbol: PRLHR Gene ID (NCBI): 2834 RRID: AB_3669450 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P49683 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.