Product Description
Size: 20ul / 150ul
The ZNF391 (24805-1-AP) by Proteintech is a Polyclonal antibody targeting ZNF391 in IP, ELISA applications with reactivity to human, mouse samples
24805-1-AP targets ZNF391 in IP, ELISA applications and shows reactivity with human, mouse samples.
Tested Applications
Positive IP detected in: mouse testis tissue
Recommended dilution
Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Background Information
ZNF391 is involved in transcriptional regulation. The calculated MW of ZFN391 is 358aa, 41 kDa. The immunogen of this antibody is 1-128aa of human ZNF391. No other protein can be recognized by this antibody from the sequence BLAST results.
Specification
Tested Reactivity: human, mouse
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag20317 Product name: Recombinant human ZNF391 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-128 aa of BC156667 Sequence: MESLRGNTAQGPTNEEDYKNEGQLSRQTKCPAQKKSSFENTVVRKVSVTLKEIFTGEEGPESSEFSLSPNLDAQQKIPKGHGSPISRKNSKDNSDLIKHQRLFSQRKPCKCNECEKAFSYQSDLLVHS Predict reactive species
Full Name: zinc finger protein 391
Calculated Molecular Weight: 3588 aa, 41 kDa
Observed Molecular Weight: 36 kDa
GenBank Accession Number: BC156667
Gene Symbol: ZNF391
Gene ID (NCBI): 346157
RRID: AB_2879736
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q9UJN7
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924