Product Description
Size: 20ul / 150ul
The NPTXR (24807-1-AP) by Proteintech is a Polyclonal antibody targeting NPTXR in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples
24807-1-AP targets NPTXR in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive WB detected in: mouse brain tissue, rat brain tissue
Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Western Blot (WB): WB : 1:1000-1:5000
Immunohistochemistry (IHC): IHC : 1:50-1:500
Background Information
NPTXR (Neuronal Pentraxin Receptor) is a type II transmembrane glycoprotein primarily expressed in the cerebellum and hippocampus. It mediates synaptic plasticity by clustering AMPA-type glutamate receptors at excitatory synapses and promoting synaptogenesis. NPTXR can be proteolytically cleaved to release a soluble form. Its dysregulation is implicated in Alzheimer's disease and small-cell lung cancer.(PMID: 9261167; 18367087; 19368810; 16115696)
Specification
Tested Reactivity: human, mouse, rat
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag20185 Product name: Recombinant human NPTXR protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 174-296 aa of BC153027 Sequence: DSPALILELEDAVRALRDRIDRLEQELPARVNLSAAPAPVSAVPTGLHSKMDQLEGQLLAQVLALEKERVALSHSSRRQRQEVEKELDVLQGRVAELEHGSSAYSPPDAFKISIPIRNNYMYA Predict reactive species
Full Name: neuronal pentraxin receptor
Calculated Molecular Weight: 489 aa, 52 kDa
Observed Molecular Weight: 55-65 kDa
GenBank Accession Number: BC153027
Gene Symbol: NPTXR
Gene ID (NCBI): 23467
RRID: AB_3085756
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: O95502
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924