Proteintech, 24807-1-AP, NPTXR Polyclonal antibody

Size: 20ul / 150ul The NPTXR (24807-1-AP) by Proteintech is a Polyclonal antibody targeting NPTXR in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 24807-1-AP targets NPTXR in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:5000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information NPTXR (Neuronal Pentraxin Receptor) is a type II transmembrane glycoprotein primarily expressed in the cerebellum and hippocampus. It mediates synaptic plasticity by clustering AMPA-type glutamate receptors at excitatory synapses and promoting synaptogenesis. NPTXR can be proteolytically cleaved to release a soluble form. Its dysregulation is implicated in Alzheimer's disease and small-cell lung cancer.(PMID: 9261167; 18367087; 19368810; 16115696) Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20185 Product name: Recombinant human NPTXR protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 174-296 aa of BC153027 Sequence: DSPALILELEDAVRALRDRIDRLEQELPARVNLSAAPAPVSAVPTGLHSKMDQLEGQLLAQVLALEKERVALSHSSRRQRQEVEKELDVLQGRVAELEHGSSAYSPPDAFKISIPIRNNYMYA Predict reactive species Full Name: neuronal pentraxin receptor Calculated Molecular Weight: 489 aa, 52 kDa Observed Molecular Weight: 55-65 kDa GenBank Accession Number: BC153027 Gene Symbol: NPTXR Gene ID (NCBI): 23467 RRID: AB_3085756 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O95502 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.