Proteintech, 24812-1-AP, TMEM154 Polyclonal antibody

Size: 20ul / 150ul The TMEM154 (24812-1-AP) by Proteintech is a Polyclonal antibody targeting TMEM154 in IHC, ELISA applications with reactivity to human samples 24812-1-AP targets TMEM154 in IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human kidney tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:20-1:200 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20054 Product name: Recombinant human TMEM154 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 91-183 aa of BC060775 Sequence: LLFVVFLATYYKRKRTKQEPSSQGSQSALQTYELGSENVKVPIFEEDTPSVMEIEMEELDKWMNSMNRNADFECLPTLKEEKESNHNPSDSES Predict reactive species Full Name: transmembrane protein 154 Calculated Molecular Weight: 183 aa, 21 kDa GenBank Accession Number: BC060775 Gene Symbol: TMEM154 Gene ID (NCBI): 201799 RRID: AB_2879738 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6P9G4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.