Iright
BRAND / VENDOR: Proteintech

Proteintech, 24824-1-AP, Vertnin Polyclonal antibody

CATALOG NUMBER: 24824-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Vertnin (24824-1-AP) by Proteintech is a Polyclonal antibody targeting Vertnin in WB, IHC, ELISA applications with reactivity to human samples 24824-1-AP targets Vertnin in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: SGC-7901 cells Positive IHC detected in: human urothelial carcinoma tissue, human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Vertnin, also named as VRTN and C14orf115, belongs to the vertnin family. It is an essential factor for development of the embryo in a wide range of organisms. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20678 Product name: Recombinant human C14orf115 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-350 aa of BC053325 Sequence: MTSRNQLVQKVLQELQEAVECEGLEGLIGASLEAKQVLSSFTLPTCREGGPGLQVLEVDSVALSLYPEDAPRNMLPLVCKGEGSLLFEAASMLLWGDAGLSLELRARTVVEMLLHRHYYLQGMIDSKVMLQAVRYSLCSEESPEMTSLPPATLEAIFDADVKASCFPSSFSNVWHLYALASVLQRNIYSIYPMRNLKIRPYFNRVIRPRRCDHVPSTLHIMWAGQPLTSHFFRHQYFAPVVGLEEVEAEGAPGVAPALPALAPLSSPAKTLELLNREPGLSYSHLCERYSVTKSTFYRWRRQSQEHRQKVAARFSAKHFLQDSFHRGGVVPLQQFLQRFPEISRSTYYAW Predict reactive species Full Name: chromosome 14 open reading frame 115 Calculated Molecular Weight: 702 aa, 78 kDa Observed Molecular Weight: 80 kDa GenBank Accession Number: BC053325 Gene Symbol: Vertnin Gene ID (NCBI): 55237 RRID: AB_2879745 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H8Y1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924