Proteintech, 24837-1-AP, POTEH Polyclonal antibody

Size: 20ul / 150ul The POTEH (24837-1-AP) by Proteintech is a Polyclonal antibody targeting POTEH in WB, ELISA applications with reactivity to human samples 24837-1-AP targets POTEH in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: DU 145 cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20275 Product name: Recombinant human POTEH protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 24-59 aa of BC148758 Sequence: MGKWCRHCFAWCRGSGKSNVGTSGDHDDSAMKTLRS Predict reactive species Full Name: POTE ankyrin domain family, member H Calculated Molecular Weight: 545 aa, 61 kDa Observed Molecular Weight: 61 kDa GenBank Accession Number: BC148758 Gene Symbol: POTEH Gene ID (NCBI): 23784 RRID: AB_2879752 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6S545 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.