Proteintech, 24842-1-AP, PDF Polyclonal antibody

Size: 20ul / 150ul The PDF (24842-1-AP) by Proteintech is a Polyclonal antibody targeting PDF in IHC, IF/ICC, ELISA applications with reactivity to human samples 24842-1-AP targets PDF in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:100-1:400 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18233 Product name: Recombinant human PDF protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 7-243 aa of bc019912 Sequence: ALSLRPLWAAVPWGGAAAVGVRACSSTAAPDGVEGPALRRSYWRHLRRLVLGPPEPPFSHVCQVGDPVLRGVAAPVERAQLGGPELQRLTQRLVQVMRRRRCVGLSAPQLGVPRQVLALELPEALCRECPPRQRALRQMEPFPLRVFVNPSLRVLDSRLVTFPEGCESVAGFLACVPRFQAVQISGLDPNGEQVVWQASGWAARIIQHEMDHLQGCLFIDKMDSRTFTNVYWMKVND Predict reactive species Full Name: peptide deformylase (mitochondrial) Calculated Molecular Weight: 243 aa, 27 kDa Observed Molecular Weight: 60 kDa GenBank Accession Number: bc019912 Gene Symbol: PDF Gene ID (NCBI): 64146 RRID: AB_2879753 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9HBH1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.