Proteintech, 24844-1-AP, SZRD1 Polyclonal antibody

Size: 20ul / 150ul The SZRD1 (24844-1-AP) by Proteintech is a Polyclonal antibody targeting SZRD1 in WB, IHC, ELISA applications with reactivity to human samples 24844-1-AP targets SZRD1 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells Positive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20507 Product name: Recombinant human SZRD1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-133 aa of BC023988 Sequence: MRRSLRAGKRRQTAGRKSKSPPKVPIVIQDDSLPAGPPPQIRILKRPTSNGVVSSPNSTSRPTLPVKSLAQREAEYAEARKRILGSASPEEEQEKPILDRPTRISQPEDSRQPNNVIRQPLGPDGSQGFKQRR Predict reactive species Full Name: chromosome 1 open reading frame 144 Calculated Molecular Weight: 152 aa, 17 kDa Observed Molecular Weight: 18-22 kDa GenBank Accession Number: BC023988 Gene Symbol: SZRD1/C1orf144 Gene ID (NCBI): 26099 RRID: AB_3085759 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q7Z422 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.