Product Description
Size: 20ul / 150ul
The CNTD1 (24854-1-AP) by Proteintech is a Polyclonal antibody targeting CNTD1 in WB, ELISA applications with reactivity to human, mouse samples
24854-1-AP targets CNTD1 in WB, ELISA applications and shows reactivity with human, mouse samples.
Tested Applications
Positive WB detected in: mouse colon tissue
Recommended dilution
Western Blot (WB): WB : 1:500-1:1000
Specification
Tested Reactivity: human, mouse
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag21338 Product name: Recombinant human CNTD1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 203-330 aa of BC026187 Sequence: MRLHATCLTLLDLVYLLHEPIYESLLRASIENSTPSQLQGEKFTSVKEDFMLLAVGIIAASAFIQNHECWSQVVGHLQSITGIALASIAEFSYAILTHGVGANTPGRQQSIPPHLAARALKTVASSNT Predict reactive species
Full Name: cyclin N-terminal domain containing 1
Calculated Molecular Weight: 330 aa, 37 kDa
Observed Molecular Weight: 35-37 kDa
GenBank Accession Number: BC026187
Gene Symbol: CNTD1
Gene ID (NCBI): 124817
RRID: AB_2879757
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q8N815
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924