Product Description
Size: 20ul / 150ul
The C19orf73 (24856-1-AP) by Proteintech is a Polyclonal antibody targeting C19orf73 in IF/ICC, ELISA applications with reactivity to human samples
24856-1-AP targets C19orf73 in IF/ICC, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive IF/ICC detected in: A549 cells
Recommended dilution
Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800
Background Information
C19orf73, now officially named Autophagy-related protein 13, is a core regulatory factor in the initiation of cellular autophagy. As a key component of the ULK1/ATG1 complex, this protein plays a critical role in responding to signals such as nutrient deprivation and energy stress. When the mTORC1 pathway is inhibited, ATG13 forms a stable activation complex with proteins including ULK1 and FIP200, initiating autophagosome formation. Dysfunction of ATG13 is closely associated with various diseases: in neurodegenerative disorders, impaired autophagy leads to abnormal protein aggregation; in tumor development, autophagy exerts dual regulatory effects on cancer progression. The expression level and activity of ATG13 are finely regulated by phosphorylation modifications, making it a crucial molecular switch connecting upstream signals with downstream autophagy execution machinery. It has become an important target in both fundamental autophagy research and the development of therapies for related diseases.
Specification
Tested Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag21567 Product name: Recombinant human C19orf73 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-129 aa of BC069712 Sequence: MRLKVGFQGGGCFRKDALCLEGGVSARWARAPHSAPLRPPRELHAAPPPATPTQTVVRPAGFPRRTRLMVRSAPPTQRPPTGSGCVSGLWRKGLGLRPQTLLRVGGVVLSSAPALRPRLGPCLRPPPSD Predict reactive species
Full Name: chromosome 19 open reading frame 73
Calculated Molecular Weight: 129 aa, 14 kDa
Observed Molecular Weight: 14 kDa
GenBank Accession Number: BC069712
Gene Symbol: C19orf73
Gene ID (NCBI): 55150
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q9NVV2
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924