Proteintech, 24857-1-AP, GPR45 Polyclonal antibody

Size: 20ul / 150ul The GPR45 (24857-1-AP) by Proteintech is a Polyclonal antibody targeting GPR45 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 24857-1-AP targets GPR45 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: rat brain tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information GPR45 (G-protein coupled receptor 45) is a member of the G protein-coupled receptor (GPCR) family. Members of this protein family contain seven putative transmembrane domains and may mediate signaling processes to the interior of the cell via activation of heterotrimeric G proteins. GPR45 may function in the central nervous system. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21541 Product name: Recombinant human GPR45 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 332-372 aa of BC066879 Sequence: REACIELLPQTFQILPKVPERIRRRIQPSTVYVCNENQSAV Predict reactive species Full Name: G protein-coupled receptor 45 Calculated Molecular Weight: 370 aa, 42 kDa Observed Molecular Weight: 47 kDa GenBank Accession Number: BC066879 Gene Symbol: GPR45 Gene ID (NCBI): 11250 RRID: AB_3669457 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y5Y3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.