Proteintech, 24867-1-AP, C22orf41 Polyclonal antibody

Size: 20ul / 150ul The C22orf41 (24867-1-AP) by Proteintech is a Polyclonal antibody targeting C22orf41 in IHC, ELISA applications with reactivity to human, mouse, rat samples 24867-1-AP targets C22orf41 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive IHC detected in: mouse testis tissue, rat testis tissue, human small intestine tissue, human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information C22orf41 is also named as SYCE3 and THEG2. C22orf41 is major component of the transverse central element of synaptonemal complexes (SCS). It formed between homologous chromosomes during meiotic prophase. SYCE3 is a small protein of 88 amino acids that is essential for SC assembly, meiotic division, and fertility (PMID:21637789). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21756 Product name: Recombinant human C22orf41 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-88 aa of BC127859 Sequence: MDDADPEERNYDNMLKMLSDLNKDLEKLLEEMEKISVQATWMAYDMVVMRTNPTLAESMRRLEDAFVNCKEEMEKNWQELLHETKQRL Predict reactive species Full Name: chromosome 22 open reading frame 41 Calculated Molecular Weight: 88 aa, 11 kDa GenBank Accession Number: BC127859 Gene Symbol: C22orf41 Gene ID (NCBI): 644186 RRID: AB_2879765 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: A1L190 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.