Iright
BRAND / VENDOR: Proteintech

Proteintech, 24890-1-AP, ANKFY1 Polyclonal antibody

CATALOG NUMBER: 24890-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ANKFY1 (24890-1-AP) by Proteintech is a Polyclonal antibody targeting ANKFY1 in WB, ELISA applications with reactivity to human samples 24890-1-AP targets ANKFY1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human placenta tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information ANKFY1 also named as ANKHZN or Ankyrin repeats hooked to a zinc finger motif is a 1169 amino acid protein, which is a cytoplasm protein on embryonic stem cells. ANKFY1 protein is ubiquitously expressed in a spatiotemporal specific manner and is located on endosomes. ANKFY1 is expressed at various levels in human tissues and also present in both membrane and soluble fractions obtained on subcellular fractionation. ANKFY1 is a single copy gene consisting of predicted 25 exons in the human genome, and has been mapped to human chromosome 17p13. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19267 Product name: Recombinant human ANKFY1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 817-1170 aa of BC152991 Sequence: GVIIQLLVSHPDIHLNVRDRQGLTPFACAMTFKNNKSAEAILKRESGAAEQVDNKGRNFLHVAVQNSDIESVLFLISVHANVNSRVQDASKLTPLHLAVQAGSEIIVRNLLLAGAKVNELTKHRQTALHLAAQQDLPTICSVLLENGVDFAAVDENGNNALHLAVMHGRLNNIRVLLTECTVDAEAFNLRGQSPLHILGQYGKENAAAIFDLFLECMPGYPLDKPDADGSTVLLLAYMKGNANLCRAIVRSGARLGVNNNQGVNIFNYQVATKQLLFRLLDMLSKEPPWCDGSYCYECTARFGVTTRKHHCRHCGRLLCHKCSTKEIPIIKFDLNKPVRVCNICFDVLTLGGVS Predict reactive species Full Name: ankyrin repeat and FYVE domain containing 1 Calculated Molecular Weight: 1169 aa, 129 kDa Observed Molecular Weight: 125-135 kDa GenBank Accession Number: BC152991 Gene Symbol: ANKFY1 Gene ID (NCBI): 51479 RRID: AB_3669459 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9P2R3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924