Proteintech, 24898-1-AP, TMEM161A Polyclonal antibody

Size: 20ul / 150ul The TMEM161A (24898-1-AP) by Proteintech is a Polyclonal antibody targeting TMEM161A in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 24898-1-AP targets TMEM161A in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: MCF-7 cells, mouse liver tissue, rat liver tissue Positive IHC detected in: mouse brain tissue, human brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information TMEM161A also named as transmembrane protein 161A is a 479 amino acid protein which belongs to TMEM161 family. The molecular weight of TMEM161A is 56 kDa or 42 kDa. TMEM161A is a multi-pass membrane protein and localizes to the cell membrane. It may be involved in the negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage and cellular response to oxidative stress. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18974 Product name: Recombinant human TMEM161A protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 364-460 aa of BC005210 Sequence: VVRVYCYVTVVSLQYLTPLILTLNCTLLLKTLGGYSWGLGPAPLLSPDPSSASAAPIGSGEDEVQQTAARIAGALGGLLTPLFLRGVLAYLIWWTAA Predict reactive species Full Name: transmembrane protein 161A Calculated Molecular Weight: 479 aa, 54 kDa Observed Molecular Weight: 45 kDa GenBank Accession Number: BC005210 Gene Symbol: TMEM161A Gene ID (NCBI): 54929 RRID: AB_2879785 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NX61 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.