Proteintech, 24899-1-AP, LRP5 Polyclonal antibody

Size: 20ul / 150ul The LRP5 (24899-1-AP) by Proteintech is a Polyclonal antibody targeting LRP5 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 24899-1-AP targets LRP5 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells Positive IHC detected in: mouse lung tissue, human hepatocirrhosis tissue, human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Low-density lipoprotein receptor-related protein 5 (LRP5) is a single-pass type I membrane protein with EGF-like and LDLR domains in the extracellular domain. LRP5 and LRP6 act as coreceptors with Frizzled for Wnt. The complex of Wnt-Fzd-LRP5-LRP6 triggers beta-catenin signaling through inducing aggregation of receptor-ligand complexes into ribosome-sized signalsomes. LRP5 plays a key role in skeletal homeostasis and many bone density related diseases are caused by mutations in LRP5 gene. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19034 Product name: Recombinant human LRP5 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1332-1397 aa of BC150595 Sequence: CDAICLPNQFRCASGQCVLIKQQCDSFPDCIDGSDELMCEITKPPSDDSPAHSSAIGPVIGIILSL Predict reactive species Full Name: low density lipoprotein receptor-related protein 5 Calculated Molecular Weight: 1615 aa, 179 kDa Observed Molecular Weight: 180-200 kDa GenBank Accession Number: BC150595 Gene Symbol: LRP5 Gene ID (NCBI): 4041 RRID: AB_2879786 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O75197 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.