Proteintech, 24929-1-AP, FAM155A Polyclonal antibody

Size: 20ul / 150ul The FAM155A (24929-1-AP) by Proteintech is a Polyclonal antibody targeting FAM155A in WB, IHC, ELISA applications with reactivity to human samples 24929-1-AP targets FAM155A in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: K-562 cells, COLO 320 cells Positive IHC detected in: human colon cancer tissue, human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information FAM155A is a transmembrane protein with glycosylation. The MW is from 49-55 kDa. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21575 Product name: Recombinant human FAM155A protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 58-272 aa of BC157830 Sequence: FCAEAKLTRARDKEHQQQQRQQQQQQQQQRQRQQQQQQRRQQEPSWPALLASMGESSPAAQAHRLLSASSSPTLPPSPGDGGGGGGKGNRGKDDRGKALFLGNSAKPVWRLETCYPQGASSGQCFTVENADAVCARNWSRGAAGGDGQEVRSKHPTPLWNLSDFYLSFCNSYTLWELFSGLSSPNTLNCSLDVVLKEGGEMTTCRQCVEAYQDYD Predict reactive species Full Name: family with sequence similarity 155, member A Calculated Molecular Weight: 458 aa, 51 kDa Observed Molecular Weight: 49-55 kDa GenBank Accession Number: BC157830 Gene Symbol: FAM155A Gene ID (NCBI): 728215 RRID: AB_2879803 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: B1AL88 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.