Iright
BRAND / VENDOR: Proteintech

Proteintech, 24931-1-AP, SRBD1 Polyclonal antibody

CATALOG NUMBER: 24931-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SRBD1 (24931-1-AP) by Proteintech is a Polyclonal antibody targeting SRBD1 in WB, IP, IHC, ELISA applications with reactivity to human, mouse samples 24931-1-AP targets SRBD1 in WB, IP, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: SH-SY5Y cells Positive IP detected in: mouse brain tissue Positive IHC detected in: human brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information S1 RNA-binding domain-containing protein 1 (SRBD1) is a 995 amino acid protein, which contains one S1 motif domain. SRBD1 is a susceptibility gene for normal tension glaucoma (NTG) and may be involved in cell growth inhibition and apoptosis. Two isoforms of SRBD1 exist due to alternative splicing events, and the gene which encodes SRBD1 maps to human chromosome 2p21. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21661 Product name: Recombinant human SRBD1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 657-995 aa of BC032538 Sequence: SIARRVQDPLAELVKIEPKHIGVGMYQHDVSQTLLKATLDSVVEECVSFVGVDINICSEVLLRHIAGLNANRAKNIIEWREKNGPFINREQLKKVKGLGPKSFQQCAGFIRINQDYIRTFCSQQTETSGQIQGVAVTSSADVEVTNEKQGKKKSKTAVNVLLKPNPLDQTCIHPESYDIAMRFLSSIGGTLYEVGKPEMQQKINSFLEKEGMEKIAERLQTTVHTLQVIIDGLSQPESFDFRTDFDKPDFKRSIVCLEDLQIGTVLTGKVENATLFGIFVDIGVGKSGLIPIRNVTEAKLSKTKKRRSLGLGPGERVEVQVLNIDIPRSRITLDLIRVL Predict reactive species Full Name: S1 RNA binding domain 1 Calculated Molecular Weight: 995 aa, 112 kDa Observed Molecular Weight: 100-120 kDa GenBank Accession Number: BC032538 Gene Symbol: SRBD1 Gene ID (NCBI): 55133 RRID: AB_2879805 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8N5C6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924