Iright
BRAND / VENDOR: Proteintech

Proteintech, 24934-1-AP, ADAMTS12 Polyclonal antibody

CATALOG NUMBER: 24934-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ADAMTS12 (24934-1-AP) by Proteintech is a Polyclonal antibody targeting ADAMTS12 in WB, IF/ICC, ELISA applications with reactivity to human, mouse samples 24934-1-AP targets ADAMTS12 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse placenta tissue, NIH/3T3 cells Positive IF/ICC detected in: NIH/3T3 cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information ADAMTS12(A disintegrin and metalloproteinase with thrombospondin motifs 12) is also named as AT12, ADAM-TS12, PRO4389 and belongs to the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) protein family. It may play roles in pulmonary cells during fetal development or in tumor processes through its proteolytic activity or as a molecule potentially involved in regulation of cell adhesion. ADAMTS7 and ADAMTS12 appear to be potent negative regulators of endplate cartilage development(PMID:22247065). This protein has 3 isoforms produced by alternative splicing. The full length protein has 14 glycosylation sites. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20712 Product name: Recombinant human ADAMTS12 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-229 aa of BC058841 Sequence: MPCAQRSWLANLSVVAQLLNFGALCYGRQPQPGPVRFPDRRQEHFIKGLPEYHVVGPVRVDASGHFLSYGLHYPITSSRRKRDLDGSEDWVYYRISHEEKDLFFNLTVNQGFLSNSYIMEKRYGNLSHVKMMASSAPLCHLSGTVLQQGTRVGTAALSACHGLTGFFQLPHGDFFIEPVKKHPLVEGGYHPHIVYRRQKVPETKEPTCGLKGIVTHMSSWVEESVLFFW Predict reactive species Full Name: ADAM metallopeptidase with thrombospondin type 1 motif, 12 Calculated Molecular Weight: 178 kDa Observed Molecular Weight: 155 kDa GenBank Accession Number: BC058841 Gene Symbol: ADAMTS12 Gene ID (NCBI): 81792 RRID: AB_2879806 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P58397 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924