Iright
BRAND / VENDOR: Proteintech

Proteintech, 24953-1-AP, C6orf15 Polyclonal antibody

CATALOG NUMBER: 24953-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The C6orf15 (24953-1-AP) by Proteintech is a Polyclonal antibody targeting C6orf15 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 24953-1-AP targets C6orf15 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: A375 cells Positive IHC detected in: mouse skin tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A375 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information C6orf15, also named as Protein STG, is a 325 amino acid protein, which as a secreted protein is expressed in skin and tonsils. The calculated molecular weight of C6orf15 is 34 kDa, but we detected a 50-55 kDa protein by western blot. C6orf15 may contains some modified residues. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20276 Product name: Recombinant human C6orf15 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 27-325 aa of BC153157 Sequence: RSIGVVEEKVSQNLGTNLPQLGQPSSTGPSNSEHPQPALDPRSNDLARVPLKLSVPASDGFPPAGGSAVQRWPPSWGLPAMDSWPPEDPWQMMAAAAEDRLGEALPEELSYLSSAAALAPGSGPLPGESSPDATGLSPKASLLHQDSESRRLPRSNSLGAGGKILSQRPPWSLIHRVLPDHPWGTLNPSVSWGGGGPGTGWGTRPMPHPEGIWGINNQPPGTSWGNINRYPGGSWGNINRYPGGSWGNINRYPGGSWGNIHLYPGINNPFPPGVLRPPGSSWNIPAGFPNPPSPRLQWG Predict reactive species Full Name: chromosome 6 open reading frame 15 Calculated Molecular Weight: 325 aa, 34 kDa Observed Molecular Weight: 50-55 kDa GenBank Accession Number: BC153157 Gene Symbol: C6orf15 Gene ID (NCBI): 29113 RRID: AB_2879818 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6UXA7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924