Iright
BRAND / VENDOR: Proteintech

Proteintech, 24980-1-AP, SPATA1 Polyclonal antibody

CATALOG NUMBER: 24980-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SPATA1 (24980-1-AP) by Proteintech is a Polyclonal antibody targeting SPATA1 in WB, ELISA applications with reactivity to human, mouse samples 24980-1-AP targets SPATA1 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: human testis tissue, mouse testis tissue Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21784 Product name: Recombinant human SPATA1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-284 aa of BC127634 Sequence: MKKDKKRNKIPIDNYPIQTLVNMSLNPSRPSSSELVELHVFYVPEGSWNYKLNTISTEVVNKFISAGFLRVSPQLTLRALRERLGEFLGEDAIAEKFLFLKCIGNNLAVVKEKQESELKLKSFAPPYALQPELYLLPVMDHLGNVYSPSTVILDERQTNNGVNEADGTIHRPISVTLFKEELGRDPSLLENTLKELPNKNQEEAGGKATAEKSQIAKNQIGNSELPGSLEDSNNDCFGTKKSVFGKMKMIQLSVEDRTIRQLKKSTSPYQITLHFLVNLFFLQE Predict reactive species Full Name: spermatogenesis associated 1 Calculated Molecular Weight: 437 aa, 50 kDa Observed Molecular Weight: 40-50 kDa GenBank Accession Number: BC127634 Gene Symbol: SPATA1 Gene ID (NCBI): 64173 RRID: AB_2879830 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q5VX52 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924