Proteintech, 24981-1-AP, FDXACB1 Polyclonal antibody

Size: 20ul / 150ul The FDXACB1 (24981-1-AP) by Proteintech is a Polyclonal antibody targeting FDXACB1 in WB, IHC, ELISA applications with reactivity to human samples 24981-1-AP targets FDXACB1 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human placenta tissue, PC-3 cells Positive IHC detected in: human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21785 Product name: Recombinant human FDXACB1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 269-624 aa of BC127680 Sequence: LPQEGTSVLPFWNCDFLSAAFWISLHEDNSNSESLTGGTSQDVEDFLVSFSELSLLKNPGRDGKEEACEGTCGQAKICLRPSLLVHVQDVIEVPDFLSGSLHILSGPVFQKCHILPFTMPAFHETLFILGVNQNLKDGCLQSLLDHLKGILDSLLTQTLPESSKLSSLVKFVLQSNGKDYMIRVKTHNFSPDCTEDLIIGSVITSATSVIHKDQCFVFVSMNLDLLAMLVWCISDWRMLWTFDNRFLKNFVPGKIEPFKSHSLYPPCYVHDVSFWIDQKKGFDELEFHTVARAVSQDTIISIQFLSRFQHPKTQQVSLCYRLTYQTCDKALTQQQVASMQSQFRKEIQQHLYVIPR Predict reactive species Full Name: ferredoxin-fold anticodon binding domain containing 1 Calculated Molecular Weight: 624 aa, 70 kDa Observed Molecular Weight: 65-70 kDa GenBank Accession Number: BC127680 Gene Symbol: FDXACB1 Gene ID (NCBI): 91893 RRID: AB_2879831 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BRP7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.