Iright
BRAND / VENDOR: Proteintech

Proteintech, 25013-1-AP, PIPPIN Polyclonal antibody

CATALOG NUMBER: 25013-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PIPPIN (25013-1-AP) by Proteintech is a Polyclonal antibody targeting PIPPIN in WB, IHC, ELISA applications with reactivity to human, mouse samples 25013-1-AP targets PIPPIN in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse brain tissue Positive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information PIPPIN, also known as CSDC2 (Cold shock domain-containing protein C2) is an RNA‐binding protein (RBP), highly enriched in the rat brain, specifically enriched in some pyramidal neurons of the cerebral cortex and in the Purkinje cells of the cerebellum (PMID: 10446180). PIPPIN has the potential to undergo different posttranslational modifications and might be a good candidate to regulate the synthesis of specific proteins in response to extracellular stimuli. Nuclear CSDC2 is connected to proliferation and cytoplasmic CSDC2 to terminal differentiation in the decidua and that CSDC2 could regulate differentiation during decidua development (PMID: 30078185, PMID: 17053029). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16216 Product name: Recombinant human CSDC2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-103 aa of BC067113 Sequence: MTSESTSPPVVPPLHSPKSPVWPTFPFHREGSRVWERGGVPPRDLPSPLPTKRTRTYSATARASAGPVFKGVCKQFSRSQGHGFITPENGSEDIFVHVSDIEG Predict reactive species Full Name: cold shock domain containing C2, RNA binding Calculated Molecular Weight: 153 aa, 17 kDa Observed Molecular Weight: 30 kDa GenBank Accession Number: BC067113 Gene Symbol: CSDC2 Gene ID (NCBI): 27254 RRID: AB_2879845 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y534 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924