Iright
BRAND / VENDOR: Proteintech

Proteintech, 25021-1-AP, DEC1 Polyclonal antibody

CATALOG NUMBER: 25021-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The DEC1 (25021-1-AP) by Proteintech is a Polyclonal antibody targeting DEC1 in IHC, ELISA applications with reactivity to human samples 25021-1-AP targets DEC1 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human prostate cancer tissue, human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information DEC1 (Deleted in esophageal cancer 1), also named as CTS9 (Candidate tumor suppressor CTS9),is a tumor suppressor protein. It is expressed in many tissues, with highest expression in prostate and testis. This gene is different to another DEC1 protein (Differentially expressed in chondrocytes protein 1, BHLHE40). Specification Tested Reactivity: human Cited Reactivity: rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20192 Product name: Recombinant human DEC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-70 aa of BC153139 Sequence: MTMNVLEAGKWKSIVPAPGEGLLAVLHMMVFTDALHRERSVKWQAGVCYNGGKDFAVSLARPKAAEGIAD Predict reactive species Full Name: deleted in esophageal cancer 1 Calculated Molecular Weight: 70 aa, 8 kDa GenBank Accession Number: BC153139 Gene Symbol: DEC1 Gene ID (NCBI): 50514 RRID: AB_2879851 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9P2X7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924