Proteintech, 25023-1-AP, ZNF586 Polyclonal antibody

Size: 20ul / 150ul The ZNF586 (25023-1-AP) by Proteintech is a Polyclonal antibody targeting ZNF586 in WB, ELISA applications with reactivity to human samples 25023-1-AP targets ZNF586 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HepG2 cells, COLO 320 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21732 Product name: Recombinant human ZNF586 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-210 aa of BC124558 Sequence: MAAAAALRAPAQVVGMEGKMRQHLLSRARVYIYTKTREVIVEKGLMSVGNIGNYLRTSPASLNPEEITNTGMFALEKGLMSAANMGNYFTKSLHSIFMRDFILGKRPMSAVSVENHFTKALHSCSVRHFTLEKGLMSVLNVGKPLLKSPVSLTTGKFTLEQSVMNAMNVGSPLLIHLVSLNTGGFTLERGLMSAVNVGDPLLKTPVLLNT Predict reactive species Full Name: zinc finger protein 586 Calculated Molecular Weight: 402 aa, 46 kDa Observed Molecular Weight: 46 kDa GenBank Accession Number: BC124558 Gene Symbol: ZNF586 Gene ID (NCBI): 54807 RRID: AB_2879853 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NXT0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.