Proteintech, 25029-1-AP, PAG1 Polyclonal antibody

Size: 20ul / 150ul The PAG1 (25029-1-AP) by Proteintech is a Polyclonal antibody targeting PAG1 in WB, IHC, ELISA applications with reactivity to human, mouse samples 25029-1-AP targets PAG1 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse brain tissue Positive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information PAG1, also named as CBP and PAG, promotes CSK activation and recruitment to lipid rafts, which results in LCK inhibition. It is involved in cell adhesion signaling. PAG1 may play an important role in inhibiting the proliferation, invasion and metastasis of the cancer cells. PAG1 is a membrane protein with phosphor modification. The MW of PAG1 migrates to 50-65 kDa in WB detection. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13393 Product name: Recombinant human PAG1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 82-432 aa of BC112159 Sequence: EQNGALTNGDILSEDSTLTCMQHYEEVQTSASDLLDSQDSTGKPKCHQSRELPRIPPESAVDTMLTARSVDGDQGLGMEGPYEVLKDSSSQENMVEDCLYETVKEIKEVAAAAHLEKGHSGKAKSTSASKELPGPQTEGKAEFAEYASVDRNKKCRQSVNVESILGNSCDPEEEAPPPVPVKLLDENENLQEKEGGEAEESATDTTSETNKRFSSLSYKSREEDPTLTEEEISAMYSSVNKPGQLVNKSGQSLTVPESTYTSIQGDPQRSPSSCNDLYATVKDFEKTPNSTLPPAGRPSEEPEPDYEAIQTLNREEEKATLGTNGHHGLVPKENDYESISDLQQGRDITRL Predict reactive species Full Name: phosphoprotein associated with glycosphingolipid microdomains 1 Calculated Molecular Weight: 432 aa, 47 kDa Observed Molecular Weight: 50-60 kDa GenBank Accession Number: BC112159 Gene Symbol: PAG1 Gene ID (NCBI): 55824 RRID: AB_2879858 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NWQ8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.