Iright
BRAND / VENDOR: Proteintech

Proteintech, 25034-1-AP, ANKRD49 Polyclonal antibody

CATALOG NUMBER: 25034-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ANKRD49 (25034-1-AP) by Proteintech is a Polyclonal antibody targeting ANKRD49 in WB, ELISA applications with reactivity to human, mouse, rat samples 25034-1-AP targets ANKRD49 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse testis tissue, rat testis tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information Ankyrin repeat domain-containing protein 49 (ANKRD49), an evolutionarily conserved protein highly expressed in the testes, is mainly found in spermatogonia, spermatocytes, and round spermatids. ANKRD49 also participates in the progression of malignant gliomas and gastric cancer in humans. (PMID: 37964204, PMID: 30798416) Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18295 Product name: Recombinant human ANKRD49 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 8-239 aa of BC017798 Sequence: DDGIPDQENSLDFSEHFNQLELLETHGHLIPTGTQSLWVGNSDEDEEQDDKNEEWYRLQEKKMEKDPSRLLLWAAEKNRLTTVRRLLSEKATHVNTRDEDEYTPLHRAAYSGHLDIVQELIAQGADVHAVTVDGWTPLHSACKWNNTRVASFLLQHDADINAQTKGLLTPLHLAAGNRDSKDTLELLLMNRYVKPGLKNNLEETAFDIARRTSIYHYLFEIVEGCTNSSPQS Predict reactive species Full Name: ankyrin repeat domain 49 Calculated Molecular Weight: 239 aa, 27 kDa Observed Molecular Weight: 27-30 kDa GenBank Accession Number: BC017798 Gene Symbol: ANKRD49 Gene ID (NCBI): 54851 RRID: AB_2879860 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8WVL7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924