Iright
BRAND / VENDOR: Proteintech

Proteintech, 25043-1-AP, CAPZB Polyclonal antibody

CATALOG NUMBER: 25043-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CAPZB (25043-1-AP) by Proteintech is a Polyclonal antibody targeting CAPZB in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 25043-1-AP targets CAPZB in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A431 cells, mouse testis tissue, HEK-293 cells, HeLa cells, Jurkat cells, NIH/3T3 cells, mouse heart tissue, rat heart tissue, mouse skeletal muscle tissue Positive IHC detected in: human skin cancer tissue, mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:300-1:1200 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information CAPZB belongs to the F-actin-capping protein beta subunit family and is the β subunit of the heterodimeric F-actin cap-binding protein. F-actin-capping proteins bind in a Ca2+-independent manner to the fast-growing ends of actin filaments, thereby blocking the exchange of subunits at these ends. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19327 Product name: Recombinant human CAPZB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 2-243 aa of BC109241 Sequence: SDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKSGSGTMNLGGSLTRQMEKDETVSDCSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGL Predict reactive species Full Name: capping protein (actin filament) muscle Z-line, beta Calculated Molecular Weight: 277 aa, 31 kDa Observed Molecular Weight: 30-31 kDa GenBank Accession Number: BC109241 Gene Symbol: CAPZB Gene ID (NCBI): 832 RRID: AB_2879867 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P47756 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924