Proteintech, 25061-1-AP, RNF135 Polyclonal antibody

Size: 20ul / 150ul The RNF135 (25061-1-AP) by Proteintech is a Polyclonal antibody targeting RNF135 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 25061-1-AP targets RNF135 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse kidney tissue, U-251 cells, U-87 MG cells Positive IHC detected in: human kidney tissue, human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: PC-12 cells, HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:200-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Ring finger protein 135 (RNF135), located on chromosome 17q11.2, is a RING finger domain-containing E3 ubiquitin ligase that was identified as a bio-marker and therapy target of glioblastoma (PMID: 26856755). RNF135 facilitates RIG-I C-terminal ubiquitination to up-regulate RIG-I-mediated IFN signaling and suppress viral replication. This antibody can detect a band at 48 kDa as predicted. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18821 Product name: Recombinant human RNF135 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-210 aa of BC005084 Sequence: MAGLGLGSAVPVWLAEDDLGCIICQGLLDWPATLPCGHSFCRHCLEALWGARDARRWACPTCRQGAAQQPHLRKNTLLQDLADKYRRAAREIQAGSDPAHCPCPGSSSLSSAAARPRRRPELQRVAVEKSITEVAQELTELVEHLVDIVRSLQNQRPLSESGPDNELSILGKENSWKPRLPPHAHCLTRATLHSGELLGLLSGPSIQPLT Predict reactive species Full Name: ring finger protein 135 Calculated Molecular Weight: 432 aa, 48 kDa Observed Molecular Weight: 48 kDa GenBank Accession Number: BC005084 Gene Symbol: RNF135 Gene ID (NCBI): 84282 RRID: AB_2879879 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8IUD6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.